This product is intended for laboratory research use only.
Not for human or veterinary use.
Not approved for diagnostic, therapeutic, or medical applications.
Handle using appropriate laboratory safety procedures and personal protective equipment.
FOXO4-DRI is a synthetic D-retro-inverso peptide designed to selectively disrupt the FOXO4–p53 protein-protein interaction. The compound was developed by Peter de Keizer and colleagues at Erasmus University Medical Center (Rotterdam) and published in a landmark 2017 Cell paper (Baar et al., Cell 169:132-147) demonstrating selective induction of apoptosis in cellular senescence research models. The "D-retro-inverso" design replaces all L-amino acids with D-amino acids and reverses the sequence — a structural strategy that preserves the side-chain topology of the original FOXO4 binding region while making the peptide resistant to proteolytic degradation, dramatically extending plasma half-life compared to the natural L-form. FOXO4-DRI has been investigated extensively in preclinical academic literature for p53 transactivation domain binding, senescence-associated apoptosis pathway research, p16 and IL-6 marker dynamics in senescent cell research models, and SASP (senescence-associated secretory phenotype) signaling. The compound is used primarily as a research tool for FOXO4-p53 interaction pharmacology and protein-protein interaction (PPI) inhibitor research.
• FOXO4-p53 PPI research — studied as a selective disruptor of the FOXO4–p53 protein-protein interaction in cellular research models
• p53 transactivation domain pharmacology — investigated for targeting the p53 transactivation domain surface in PPI inhibitor research
• Cellular senescence research — explored for senescence-associated apoptosis pathway endpoints in cell culture research models
• D-retro-inverso peptide chemistry — examined for peptidase resistance and SAR studies of D-amino-acid sequence-reversed peptide design
• SASP marker research — researched for senescence-associated secretory phenotype marker dynamics (p16, IL-6) in cell research
• FOXO4-p53 binding interface analysis and competitive PPI disruption assays
• p16INK4a, IL-6, and other SASP marker expression in senescent cell research models
• Apoptosis induction (caspase activation, Annexin V staining) in senescent versus non-senescent cell research
• D-retro-inverso versus L-peptide comparative stability and biological activity research
• Comparative pharmacology versus other senolytic research compounds and PPI inhibitors
• Form: Lyophilized white powder
• Net Peptide Content: 10 mg per vial
• Quantity: 1 vial
• Appearance: White to off-white lyophilizate
• Reconstitution: Bacteriostatic or sterile water (added by the end researcher)
• Purity: ≥99% by HPLC
• Identity: MS-verified (per COA)
• Storage: Protect from light
• Compound: FOXO4-DRI
• Synonyms: FOXO4 D-retro-inverso peptide; FOXO4 DRI; ProxoFIM; PPI-FOXO4 inhibitor research peptide
• Class: Synthetic D-retro-inverso peptide; 34-amino-acid research analog; FOXO4-p53 protein-protein interaction inhibitor
• Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP — all D-amino acids in retro-inverso configuration (34 residues)
• Origin: Developed by Peter de Keizer and colleagues at Erasmus University Medical Center (Rotterdam); published in Cell 2017 (Baar et al.)
• Formula / M.W.: ~C228H388N86O64, ~5358 g/mol (verify exact formula against batch COA)
• CAS: 2460055-10-9
⚠️ Disclaimer
This product is intended for laboratory research use only.
Not for human or veterinary use.
Not approved for diagnostic, therapeutic, or medical applications.
Handle using appropriate laboratory safety procedures and personal protective equipment.
COA Verification Notice: Even if the vial label or product image states a certain concentration, always go by the COA for the true verified value. We reference the COA to determine the verified concentration and purity of each product, regardless of what the label or product image indicates.
Every batch ships with a matching Certificate of Analysis. The batch number printed on your vial corresponds directly to its published certificate. Verify any batch on our Testing & COAs page.
Orders placed before 5 PM ET ship the same business day via Xpresspost. Most Canadian addresses receive delivery within 1–2 business days. Free shipping applies automatically on orders over $200.
Store refrigerated at 2–8 °C, protected from light. For laboratory research use only — not for human consumption.
This site contains research-use-only materials. You must confirm you are of legal age to continue.