Free shipping over $200Xpresspost 1–2 business daysOrders before 5 PM ET ship the same dayDouble-verified COAs — 99%+ purity Free shipping over $200Xpresspost 1–2 business daysOrders before 5 PM ET ship the same dayDouble-verified COAs — 99%+ purity
Healing & Recovery

Wolverine Stack — BPC-157 + TB-500 20mg

★★★★★4.9 · Janoshik double-verified
$124.99
● In stock · ships same business day
  • This product is intended for laboratory research use only.

  • Not for human or veterinary use.

  • Not approved for diagnostic, therapeutic, or medical applications.

  • Handle using appropriate laboratory safety procedures and personal protective equipment.

  • Double-verified COA (Janoshik) included
  • Xpresspost 1–2 business days · Free over $200
  • Store cold 2–8 °C · reconstitute with BAC water

The Wolverine Stack is a dual-component lyophilized research blend combining two of the most extensively studied tissue repair peptides in a single vial: BPC-157 (Body Protection Compound-157, a synthetic 15-amino-acid peptide derived from gastric juice) and TB-500 / Thymosin Beta-4 (a naturally occurring 43-amino-acid β-thymosin family peptide). The two compounds engage distinct but complementary research pathways — BPC-157 is primarily investigated for angiogenesis, fibroblast migration, and nitric oxide modulation, while TB-500 is studied for G-actin sequestering activity and cytoskeletal reorganization in cell migration. The Wolverine Stack is intended as a comparative pharmacology research blend for investigators studying tissue repair pathway interactions and combined β-thymosin / pentadecapeptide signaling in preclinical models.

Benefits (Research Focus)

Combined pathway research — studied for paired investigation of pentadecapeptide (BPC-157) and β-thymosin (TB-500) signaling

Angiogenesis & vascularization — investigated for combined effects on new blood vessel formation and endothelial pathway endpoints

Connective tissue research — explored for tendon and ligament repair endpoints in preclinical recovery models

Cell migration & cytoskeletal dynamics — examined for combined fibroblast migration and actin sequestration activity

Comparative pharmacology — researched for paired-compound vs single-compound endpoint differences in tissue repair models

What Researchers Look At

• Comparative angiogenesis markers (VEGF, integrins) versus single-compound BPC-157 or TB-500 administration

• Fibroblast migration, collagen synthesis, and wound closure rates in combined-treatment protocols

• G-actin / F-actin dynamics and cytoskeletal reorganization in cell migration assays

• Tendon-to-bone healing endpoints in surgical research models

• Nitric oxide pathway modulation and anti-inflammatory signaling profiles

Quick Specs

• Form: Lyophilized white powder (dual-component blend)

• BPC-157: 10 mg per vial

• TB-500: 10 mg per vial

• Total Peptide Content: 20 mg per vial

• Quantity: 1 vial

• Appearance: White to off-white lyophilizate

• Reconstitution: Bacteriostatic or sterile water (added by the end researcher)

• Purity: ≥99% by HPLC (per component)

• Identity: MS-verified (per COA)

• Storage: Protect from light

Identity Basics

Compound 1: BPC-157 (Body Protection Compound-157)

Class: Synthetic pentadecapeptide; gastric juice–derived tissue regenerative peptide

Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)

Formula / M.W.: C62H98N16O22, ~1419.55 g/mol

CAS: 137525-51-0

Compound 2: TB-500 (Thymosin Beta-4 / Tβ4)

Class: β-thymosin family; G-actin sequestering peptide; 43 amino acids

Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES

Formula / M.W.: C212H350N56O78S, ~4963.44 g/mol

CAS: 77591-33-4

⚠️ Disclaimer

  • This product is intended for laboratory research use only.

  • Not for human or veterinary use.

  • Not approved for diagnostic, therapeutic, or medical applications.

  • Handle using appropriate laboratory safety procedures and personal protective equipment.

COA Verification Notice: Even if the vial label or product image states a certain concentration, always go by the COA for the true verified value. We reference the COA to determine the verified concentration and purity of each product, regardless of what the label or product image indicates.

Janoshik COA — Third-Party Testing

Wolverine Stack BPC-157 / TB-500 VPeptide Canada — April 13, 2026

Wolverine Stack BPC-157 / TB-500 VPeptide — April 23, 2026

Batch certificate

Every batch ships with a matching Certificate of Analysis. The batch number printed on your vial corresponds directly to its published certificate. Verify any batch on our Testing & COAs page.

Shipping

Orders placed before 5 PM ET ship the same business day via Xpresspost. Most Canadian addresses receive delivery within 1–2 business days. Free shipping applies automatically on orders over $200.

Storage & handling

Store refrigerated at 2–8 °C, protected from light. For laboratory research use only — not for human consumption.

You may also like